NDK1, Recombinant, Arabidopsis thaliana, aa1-149, His-Tag (Nucleoside Diphosphate Kinase 1)

Catalog Number: USB-374385
Article Name: NDK1, Recombinant, Arabidopsis thaliana, aa1-149, His-Tag (Nucleoside Diphosphate Kinase 1)
Biozol Catalog Number: USB-374385
Supplier Catalog Number: 374385
Alternative Catalog Number: USB-374385-20,USB-374385-100
Manufacturer: US Biological
Category: Molekularbiologie
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. Source: Recombinant protein corresponding to aa1-149 from arabidopsis thaliana NDK1, fused to His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~20.5kD Amino Acid Sequence: MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.5
UniProt: P39207
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.