NDUFB10, Recombinant, Human, aa1-172, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 10)

Catalog Number: USB-374391
Article Name: NDUFB10, Recombinant, Human, aa1-172, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 10)
Biozol Catalog Number: USB-374391
Supplier Catalog Number: 374391
Alternative Catalog Number: USB-374391-20,USB-374391-100,USB-374391-1
Manufacturer: US Biological
Category: Molekularbiologie
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Source: Recombinant protein corresponding to aa1-172 from human NDUFB10, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.8kD Amino Acid Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.8
UniProt: O96000
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.