NEDD8, Recombinant, Human, aa1-81, GST-Tag (NEDD8)

Catalog Number: USB-374397
Article Name: NEDD8, Recombinant, Human, aa1-81, GST-Tag (NEDD8)
Biozol Catalog Number: USB-374397
Supplier Catalog Number: 374397
Alternative Catalog Number: USB-374397-20,USB-374397-100,USB-374397-1
Manufacturer: US Biological
Category: Molekularbiologie
Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins. Source: Recombinant protein corresponding to aa1-81 from human NEDD8, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.6kD Amino Acid Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.6
UniProt: Q15843
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.