NELFB, Recombinant, Human, aa8-199, GST-Tag (Negative Elongation Factor B)

Product Overview

• Article Name: NELFB, Recombinant, Human, aa8-199, GST-Tag (Negative Elongation Factor B)
• Biozol Catalog Number: USB-374400
• Supplier Catalog Number: 374400
• Alternative Catalog Number: USB-374400-20,USB-374400-100,USB-374400-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. May be able to induce chromatin unfolding. Source: Recombinant protein corresponding to aa8-199 from human NELFB, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.9kD Amino Acid Sequence: LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 48.9
• UniProt: Q8WX92
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.