NFYA3, Recombinant, Arabidopsis thaliana, aa1-340, His-Tag (Nuclear Transcription Factor Y Subunit A-3)

Catalog Number: USB-374412
Article Name: NFYA3, Recombinant, Arabidopsis thaliana, aa1-340, His-Tag (Nuclear Transcription Factor Y Subunit A-3)
Biozol Catalog Number: USB-374412
Supplier Catalog Number: 374412
Alternative Catalog Number: USB-374412-20,USB-374412-100
Manufacturer: US Biological
Category: Molekularbiologie
Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Source: Recombinant protein corresponding to aa1-340 from arabidopsis thaliana NFYA3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.6kD Amino Acid Sequence: MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.6
UniProt: Q93ZH2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.