NHP2L1, Recombinant, Human, aa2-128, His-Tag (NHP2-like Protein 1)
Biozol Catalog Number:
USB-374419
Supplier Catalog Number:
374419
Alternative Catalog Number:
USB-374419-20,USB-374419-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Binds to the 5-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding. Source: Recombinant protein corresponding to aa2-128 from human NHP2L1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16kD Amino Acid Sequence: TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted