Nkx2-2, Recombinant, Mouse, aa1-273, His-SUMO-Tag (Homeobox Protein Nkx-2.2)

Product Overview

• Article Name: Nkx2-2, Recombinant, Mouse, aa1-273, His-SUMO-Tag (Homeobox Protein Nkx-2.2)
• Biozol Catalog Number: USB-374427
• Supplier Catalog Number: 374427
• Alternative Catalog Number: USB-374427-20,USB-374427-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter. Source: Recombinant protein corresponding to aa1-273 from mouse Homeobox Protein Nkx-2.2, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~46.1kD Amino Acid Sequence: MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 46.1
• UniProt: P42586
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.