Nlrp3, Recombinant, Mouse, aa1-153, His-SUMO-Tag (NACHT, LRR and PYD Domains-containing Protein 3)

Catalog Number: USB-374429
Article Name: Nlrp3, Recombinant, Mouse, aa1-153, His-SUMO-Tag (NACHT, LRR and PYD Domains-containing Protein 3)
Biozol Catalog Number: USB-374429
Supplier Catalog Number: 374429
Alternative Catalog Number: USB-374429-20,USB-374429-100
Manufacturer: US Biological
Category: Molekularbiologie
May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA (By similarity). Activates caspase-1 as part of the NALP3 inflammasome complex in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Source: Recombinant protein corresponding to aa1-153 from mouse Nlrp3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.2kD Amino Acid Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.2
UniProt: Q8R4B8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.