NMNAT3, Recombinant, Human, aa1-215, His-SUMO-Tag (Nicotinamide Mononucleotide Adenylyltransferase 3)

Catalog Number: USB-374434
Article Name: NMNAT3, Recombinant, Human, aa1-215, His-SUMO-Tag (Nicotinamide Mononucleotide Adenylyltransferase 3)
Biozol Catalog Number: USB-374434
Supplier Catalog Number: 374434
Alternative Catalog Number: USB-374434-20,USB-374434-100,USB-374434-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the formation of NAD+ from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form, nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Can also use GTP and ITP as nucleotide donors. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD+. For the pyrophosphorolytic activity, can use NAD+, NADH, NaAD, nicotinic acid adenine dinucleotide phosphate (NHD), nicotinamide guanine dinucleotide (NGD) as substrates. Fails to cleave phosphorylated dinucleotides NADP+, NADPH and NaADP+. Protects against axonal degeneration following injury. Source: Recombinant protein corresponding to aa1-215 from human NMNAT3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.1kD Amino Acid Sequence: MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.1
UniProt: Q96T66
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.