Nox4, Recombinant, Rat, aa210-424, His-B2M-Tag (NADPH Oxidase 4)

Product Overview

• Article Name: Nox4, Recombinant, Rat, aa210-424, His-B2M-Tag (NADPH Oxidase 4)
• Biozol Catalog Number: USB-374446
• Supplier Catalog Number: 374446
• Alternative Catalog Number: USB-374446-20,USB-374446-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. Source: Recombinant protein corresponding to aa210-424 from rat Nox4, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD Amino Acid Sequence: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.6
• UniProt: Q924V1
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.