Nsf, Recombinant, Rat, aa7-209, His-Tag (Vesicle-fusing ATPase)
Biozol Catalog Number:
USB-374480
Supplier Catalog Number:
374480
Alternative Catalog Number:
USB-374480-20,USB-374480-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling. Source: Recombinant protein corresponding to aa7-209 from rat Nsf, fused to His-Tag at N-terminalm expressed in E. coli. Molecular Weight: ~26.5kD Amino Acid Sequence: QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted