Nucleoprotein, Recombinant, Rift Valley Fever Virus, aa1-245, His-SUMO-Tag (N)

Catalog Number: USB-374510
Article Name: Nucleoprotein, Recombinant, Rift Valley Fever Virus, aa1-245, His-SUMO-Tag (N)
Biozol Catalog Number: USB-374510
Supplier Catalog Number: 374510
Alternative Catalog Number: USB-374510-20,USB-374510-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-245 from rift valley fever virus N, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~43.4kD Amino Acid Sequence: MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.4
UniProt: P21700
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.