OCM, Recombinant, Mouse, aa2-109, His-SUMO-Tag (Oncomodulin)

Catalog Number: USB-374525
Article Name: OCM, Recombinant, Mouse, aa2-109, His-SUMO-Tag (Oncomodulin)
Biozol Catalog Number: USB-374525
Supplier Catalog Number: 374525
Alternative Catalog Number: USB-374525-20,USB-374525-100
Manufacturer: US Biological
Category: Molekularbiologie
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. Source: Recombinant protein corresponding to aa2-109 from mouse OCM, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~28.1kD Amino Acid Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.1
UniProt: P51879
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.