OmpA, Recombinant, Salmonella typhi, aa27-349, His-Tag (Outer Membrane Protein A)

Product Overview

• Article Name: OmpA, Recombinant, Salmonella typhi, aa27-349, His-Tag (Outer Membrane Protein A)
• Biozol Catalog Number: USB-374546
• Supplier Catalog Number: 374546
• Alternative Catalog Number: USB-374546-20,USB-374546-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes. Source: Recombinant protein corresponding to aa27-349 from salmonella typhi Outer Membrane Protein A, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.9kD Amino Acid Sequence: TWYAGAKLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEYAITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRFGQQEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVVTQPQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.9
• UniProt: Q8Z7S0
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.