ORF3, Recombinant, Potato Leafroll Virus, aa1-208, His-Tag (Major Capsid Protein)

Catalog Number: USB-374559
Article Name: ORF3, Recombinant, Potato Leafroll Virus, aa1-208, His-Tag (Major Capsid Protein)
Biozol Catalog Number: USB-374559
Supplier Catalog Number: 374559
Alternative Catalog Number: USB-374559-20,USB-374559-100
Manufacturer: US Biological
Category: Molekularbiologie
Major capsid protein. Full length recombinant protein corresponding to aa1-208 from potato leafroll virus ORF3, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot Accession: P17521 Molecular Weight: ~27.2kD Amino Acid Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.2
UniProt: P17521
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.