Osteocrin, Recombinant, Rat, aa82-131, His-SUMO-Tag (Ostn)

Product Overview

• Article Name: Osteocrin, Recombinant, Rat, aa82-131, His-SUMO-Tag (Ostn)
• Biozol Catalog Number: USB-374567
• Supplier Catalog Number: 374567
• Alternative Catalog Number: USB-374567-20,USB-374567-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle. Source: Recombinant protein corresponding to aa82-131 from rat Ostn, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~21.6kD Amino Acid Sequence: SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 21.6
• UniProt: P61365
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.