Pburs, Recombinant, Drosophila Melanogaster, aa21-141, GST-Tag (Partner of Bursicon)

Product Overview

• Article Name: Pburs, Recombinant, Drosophila Melanogaster, aa21-141, GST-Tag (Partner of Bursicon)
• Biozol Catalog Number: USB-374628
• Supplier Catalog Number: 374628
• Alternative Catalog Number: USB-374628-20,USB-374628-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk. Source: Recombinant protein corresponding to aa21-141 from drosophila melanogaster pburs, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.8kD Amino Acid Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 40.8
• UniProt: Q9VJS7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.