PIGR, Recombinant, Bovine, aa399-599, His-Tag (Polymeric Immunoglobulin Receptor)

Catalog Number: USB-374707
Article Name: PIGR, Recombinant, Bovine, aa399-599, His-Tag (Polymeric Immunoglobulin Receptor)
Biozol Catalog Number: USB-374707
Supplier Catalog Number: 374707
Alternative Catalog Number: USB-374707-20,USB-374707-100
Manufacturer: US Biological
Category: Molekularbiologie
This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmembrane segment. Source: Recombinant protein corresponding to aa399-599 from bovine PIGR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD Amino Acid Sequence: ESRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 26.1
UniProt: P81265
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.