PIGX, Recombinant, Human, aa42-230, His-SUMO-Tag (Phosphatidylinositol-glycan Biosynthesis Class X Protein)
Biozol Catalog Number:
USB-374709
Supplier Catalog Number:
374709
Alternative Catalog Number:
USB-374709-20,USB-374709-100,USB-374709-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM. Source: Recombinant protein corresponding to aa42-230 from human PIGX, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.8kD Amino Acid Sequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted