PIP, Recombinant, Human, aa29-146, His-Tag (Prolactin-inducible Protein)

Catalog Number: USB-374711
Article Name: PIP, Recombinant, Human, aa29-146, His-Tag (Prolactin-inducible Protein)
Biozol Catalog Number: USB-374711
Supplier Catalog Number: 374711
Alternative Catalog Number: USB-374711-20,USB-374711-100,USB-374711-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to 29-146 from human PIP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~17.5kD Amino Acid Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.5
UniProt: P12273
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.