Pla2g12a, Recombinant, Mouse, aa26-192, His-SUMO-Tag (Group XIIA Secretory Phospholipase A2)

Catalog Number: USB-374722
Article Name: Pla2g12a, Recombinant, Mouse, aa26-192, His-SUMO-Tag (Group XIIA Secretory Phospholipase A2)
Biozol Catalog Number: USB-374722
Supplier Catalog Number: 374722
Alternative Catalog Number: USB-374722-20,USB-374722-100
Manufacturer: US Biological
Category: Molekularbiologie
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. Source: Recombinant protein corresponding to aa26-192 from mouse PLA2G12A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.7kD Amino Acid Sequence: QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.7
UniProt: Q9EPR2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.