Pla2g2a, Recombinant, Rat, aa22-146, His-Tag (Phospholipase A2, Membrane Associated)

Product Overview

• Article Name: Pla2g2a, Recombinant, Rat, aa22-146, His-Tag (Phospholipase A2, Membrane Associated)
• Biozol Catalog Number: USB-374725
• Supplier Catalog Number: 374725
• Alternative Catalog Number: USB-374725-20,USB-374725-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Source: Recombinant protein corresponding to aa22-146 from rat Pla2g2a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.1kD Amino Acid Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 16.1
• UniProt: P14423
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.