PMAP36, Recombinant, Porcine, aa130-166, His-SUMO-Tag (Antibacterial Peptide PMAP-36)

Catalog Number: USB-374762
Article Name: PMAP36, Recombinant, Porcine, aa130-166, His-SUMO-Tag (Antibacterial Peptide PMAP-36)
Biozol Catalog Number: USB-374762
Supplier Catalog Number: 374762
Alternative Catalog Number: USB-374762-20,USB-374762-100
Manufacturer: US Biological
Category: Molekularbiologie
Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes. Source: Recombinant protein corresponding to aa130-166 from porcine Antibacterial Peptide PMAP-36, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.3kD Amino Acid Sequence: VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.3
UniProt: P49931
Purity: ~90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.