PMP2, Recombinant, Human, aa1-132, GST-Tag (Myelin P2 Protein)

Catalog Number: USB-374767
Article Name: PMP2, Recombinant, Human, aa1-132, GST-Tag (Myelin P2 Protein)
Biozol Catalog Number: USB-374767
Supplier Catalog Number: 374767
Alternative Catalog Number: USB-374767-20,USB-374767-100,USB-374767-1
Manufacturer: US Biological
Category: Molekularbiologie
May play a role in lipid transport protein in Schwann cells. May bind cholesterol. Source: Recombinant protein corresponding to aa1-132 from human PMP2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.9kD Amino Acid Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.9
UniProt: P02689
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.