Ponticulin, Recombinant, Dictyostelium Discoideum, aa23-118, His-Tag (PonA)

Catalog Number: USB-374797
Article Name: Ponticulin, Recombinant, Dictyostelium Discoideum, aa23-118, His-Tag (PonA)
Biozol Catalog Number: USB-374797
Supplier Catalog Number: 374797
Alternative Catalog Number: USB-374797-20,USB-374797-100
Manufacturer: US Biological
Category: Molekularbiologie
Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network. Source: Recombinant protein corresponding to aa23-118 from dictyostelium discoideum Ponticulin, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.9kD Amino Acid Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.9
UniProt: P54660
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.