POP7, Recombinant, Human, aa1-140, GST-Tag (Ribonuclease P Protein Subunit p20)
Biozol Catalog Number:
USB-374800
Supplier Catalog Number:
374800
Alternative Catalog Number:
USB-374800-20,USB-374800-100,USB-374800-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences. Source: Recombinant protein corresponding to aa1-140 from human POP7, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~42.7kD Amino Acid Sequence: MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted