POU2AF1, Recombinant, Human, aa1-256, His-Tag (POU Domain Class 2-associating Factor 1)

Catalog Number: USB-374804
Article Name: POU2AF1, Recombinant, Human, aa1-256, His-Tag (POU Domain Class 2-associating Factor 1)
Biozol Catalog Number: USB-374804
Supplier Catalog Number: 374804
Alternative Catalog Number: USB-374804-20,USB-374804-100,USB-374804-1
Manufacturer: US Biological
Category: Molekularbiologie
Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers. Source: Recombinant protein corresponding to aa1-256 from human POU2AF1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~31.4kD Amino Acid Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.4
UniProt: Q16633
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.