PPP1R8, Recombinant, Human, aa1-209, GST-Tag (Nuclear Inhibitor of Protein Phosphatase 1)

Catalog Number: USB-374823
Article Name: PPP1R8, Recombinant, Human, aa1-209, GST-Tag (Nuclear Inhibitor of Protein Phosphatase 1)
Biozol Catalog Number: USB-374823
Supplier Catalog Number: 374823
Alternative Catalog Number: USB-374823-20,USB-374823-100,USB-374823-1
Manufacturer: US Biological
Category: Molekularbiologie
Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3 to purines and pyrimidines in A+U-rich regions. It generates 5-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing. Source: Recombinant protein corresponding to aa1-209 from human PPP1R8, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.1kD Amino Acid Sequence: MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 52.1
UniProt: Q12972
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.