PPP2R3B, Recombinant, Human, aa1-176, His-SUMO-Tag (Serine/threonine-Protein Phosphatase 2A Regulatory Subunit B Subunit beta)

Catalog Number: USB-374825
Article Name: PPP2R3B, Recombinant, Human, aa1-176, His-SUMO-Tag (Serine/threonine-Protein Phosphatase 2A Regulatory Subunit B Subunit beta)
Biozol Catalog Number: USB-374825
Supplier Catalog Number: 374825
Alternative Catalog Number: USB-374825-20,USB-374825-100,USB-374825-1
Manufacturer: US Biological
Category: Molekularbiologie
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Source: Recombinant protein corresponding to aa1-176 from human PPP2R3B, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.1kD Amino Acid Sequence: MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.1
UniProt: Q9Y5P8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.