PPP3R2, Recombinant, Human, aa1-170, GST-Tag (Calcineurin Subunit B Type 2)

Catalog Number: USB-374828
Article Name: PPP3R2, Recombinant, Human, aa1-170, GST-Tag (Calcineurin Subunit B Type 2)
Biozol Catalog Number: USB-374828
Supplier Catalog Number: 374828
Alternative Catalog Number: USB-374828-20,USB-374828-100,USB-374828-1
Manufacturer: US Biological
Category: Molekularbiologie
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. Source: Recombinant protein corresponding to aa1-170 from human PPP3R2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.4kD Amino Acid Sequence: GNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.4
UniProt: Q96LZ3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.