Required for invasion of epithelial cells. Full-length recombinant protein corresponding to aa1-101 from Salmonella typhimurium PrgJ, fused to His-Tag at N-terminal and Myc Tag at the C-Terminal, expressed in Yeast. Accession/Uniprot: P41785. Molecular Weight: ~12.9kD Amino Acid Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
