Profilin, Recombinant, Mercurialis Annua, aa1-133, His-Tag

Catalog Number: USB-374866
Article Name: Profilin, Recombinant, Mercurialis Annua, aa1-133, His-Tag
Biozol Catalog Number: USB-374866
Supplier Catalog Number: 374866
Alternative Catalog Number: USB-374866-20,USB-374866-100
Manufacturer: US Biological
Category: Molekularbiologie
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Source: Recombinant protein corresponding to aa1-133 from mercurialis annua Profilin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD Amino Acid Sequence: MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 16.3
UniProt: O49894
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.