Protein FAM150A, Recombinant, Human, aa28-129, His-SUMO-Tag (FAM150A)

Catalog Number: USB-374877
Article Name: Protein FAM150A, Recombinant, Human, aa28-129, His-SUMO-Tag (FAM150A)
Biozol Catalog Number: USB-374877
Supplier Catalog Number: 374877
Alternative Catalog Number: USB-374877-20,USB-374877-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa28-129 from human FAM150A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD Amino Acid Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.5
UniProt: Q6UXT8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.