Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-SUMO-Tag (K3L)

Catalog Number: USB-374878
Article Name: Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-SUMO-Tag (K3L)
Biozol Catalog Number: USB-374878
Supplier Catalog Number: 374878
Alternative Catalog Number: USB-374878-20,USB-374878-100,USB-374878-1
Manufacturer: US Biological
Category: Molekularbiologie
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Recombinant protein corresponding to aa1-88 from vaccinia virus K3L, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~26.5kD Amino Acid Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.5
UniProt: P20639
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.