Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)

Catalog Number: USB-374880
Article Name: Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)
Biozol Catalog Number: USB-374880
Supplier Catalog Number: 374880
Alternative Catalog Number: USB-374880-20,USB-374880-100,USB-374880-1
Manufacturer: US Biological
Category: Molekularbiologie
Required for invasion of epithelial cells. Full-length recombinant protein corresponding to aa1-80 from Salmonella typhimurium Prgl, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Accesssion/Uniprot: P41784. Molecular Weight: ~24.9kD Amino Acid Sequence: MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.9
UniProt: P41784
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.