Protein RnfH, Recombinant, Coxiella Burnetii, aa1-101, His-SUMO-Tag (RnfH)

Product Overview

• Article Name: Protein RnfH, Recombinant, Coxiella Burnetii, aa1-101, His-SUMO-Tag (RnfH)
• Biozol Catalog Number: USB-374881
• Supplier Catalog Number: 374881
• Alternative Catalog Number: USB-374881-20, USB-374881-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-101 from coxiella burnetii rnfH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.3kD Amino Acid Sequence: MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 27.3
• UniProt: B6IZH9
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.