Protein X, Recombinant, Woodchuck Hepatitis B Virus, aa1-141, His-Tag (X)
Biozol Catalog Number:
USB-374887
Supplier Catalog Number:
374887
Alternative Catalog Number:
USB-374887-20,USB-374887-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. Effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. Source: Recombinant protein corresponding to aa1-141 from woodchuck hepatitis B virus Protein X, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.2kD Amino Acid Sequence: MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted