PRPS1, Recombinant, Human, aa2-318, His-SUMO-Tag (Ribose-phosphate Pyrophosphokinase 1)

Catalog Number: USB-374889
Article Name: PRPS1, Recombinant, Human, aa2-318, His-SUMO-Tag (Ribose-phosphate Pyrophosphokinase 1)
Biozol Catalog Number: USB-374889
Supplier Catalog Number: 374889
Alternative Catalog Number: USB-374889-20,USB-374889-100,USB-374889-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. Source: Recombinant protein corresponding to aa2-318 from human PRPS1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.7kD Amino Acid Sequence: PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 50.7
UniProt: P60891
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.