Prss1, Recombinant, Rat, aa24-246, His-Tag (Anionic Trypsin-1)

Catalog Number: USB-374891
Article Name: Prss1, Recombinant, Rat, aa24-246, His-Tag (Anionic Trypsin-1)
Biozol Catalog Number: USB-374891
Supplier Catalog Number: 374891
Alternative Catalog Number: USB-374891-20,USB-374891-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa24-246 from rat Prss1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.6kD Amino Acid Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.6
UniProt: P00762
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.