PRSS3, Recombinant, Human, aa81-303, His-Tag (Trypsin-3)

Catalog Number: USB-374893
Article Name: PRSS3, Recombinant, Human, aa81-303, His-Tag (Trypsin-3)
Biozol Catalog Number: USB-374893
Supplier Catalog Number: 374893
Alternative Catalog Number: USB-374893-20,USB-374893-100
Manufacturer: US Biological
Category: Molekularbiologie
Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5. Source: Recombinant protein corresponding to aa81-303 from human Trypsin-3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.2kD Amino Acid Sequence: IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.2
UniProt: P35030
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.