PRUNE, Recombinant, Human, aa1-168, His-Tag (Protein Prune Homolog)

Catalog Number: USB-374894
Article Name: PRUNE, Recombinant, Human, aa1-168, His-Tag (Protein Prune Homolog)
Biozol Catalog Number: USB-374894
Supplier Catalog Number: 374894
Alternative Catalog Number: USB-374894-20,USB-374894-100,USB-374894-1
Manufacturer: US Biological
Category: Molekularbiologie
Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1. Source: Recombinant protein corresponding to aa1-168 from human PRUNE, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.5kD Amino Acid Sequence: MLRKDQKTIYRQGVKVAISAIYMDLEICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.5
UniProt: Q86TP1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.