PSAP, Recombinant, Human, aa311-391, GST-Tag (Proactivator Polypeptide)

Catalog Number: USB-374896
Article Name: PSAP, Recombinant, Human, aa311-391, GST-Tag (Proactivator Polypeptide)
Biozol Catalog Number: USB-374896
Supplier Catalog Number: 374896
Alternative Catalog Number: USB-374896-20,USB-374896-100,USB-374896-1
Manufacturer: US Biological
Category: Molekularbiologie
Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate. Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases. Saposin-D is a specific sphingomyelin phosphodiesterase activator (EC 3.1.4.12). Prosaposin: Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling. Source: Recombinant protein corresponding to aa311-391 from human PSAP, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.1kD Amino Acid Sequence: SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 36.1
UniProt: P07602
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in PBS, pH 7.4, 20% glycerol.