PSMA1, Recombinant, Human, aa1-251, His-Tag (Proteasome Subunit Alpha Type-1)

Catalog Number: USB-374904
Article Name: PSMA1, Recombinant, Human, aa1-251, His-Tag (Proteasome Subunit Alpha Type-1)
Biozol Catalog Number: USB-374904
Supplier Catalog Number: 374904
Alternative Catalog Number: USB-374904-20,USB-374904-100,USB-374904-1
Manufacturer: US Biological
Category: Molekularbiologie
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome. Might be involved in the anti-inflammatory response of macrophages during the interaction with C. albicans heat-inactivated cells. Source: Recombinant protein corresponding to aa1-251 from human PSMA1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.2kD Amino Acid Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.2
UniProt: P25786
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.