PSMB10, Recombinant, Human, aa1-273, GST-Tag (Proteasome Subunit beta Type-10)

Catalog Number: USB-374907
Article Name: PSMB10, Recombinant, Human, aa1-273, GST-Tag (Proteasome Subunit beta Type-10)
Biozol Catalog Number: USB-374907
Supplier Catalog Number: 374907
Alternative Catalog Number: USB-374907-20,USB-374907-100,USB-374907-1
Manufacturer: US Biological
Category: Molekularbiologie
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Source: Recombinant protein corresponding to aa1-273 from human PSMB10, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~51.6kD Amino Acid Sequence: TTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 51.6
UniProt: P40306
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.