PSMB4, Recombinant, Human, aa46-264, GST-Tag (Proteasome Subunit beta Type-4)

Catalog Number: USB-374910
Article Name: PSMB4, Recombinant, Human, aa46-264, GST-Tag (Proteasome Subunit beta Type-4)
Biozol Catalog Number: USB-374910
Supplier Catalog Number: 374910
Alternative Catalog Number: USB-374910-20,USB-374910-100,USB-374910-1
Manufacturer: US Biological
Category: Molekularbiologie
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal macrophage proteasome. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Source: Recombinant protein corresponding to aa46-264 from human PSMB4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.4kD Amino Acid Sequence: TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 51.4
UniProt: P28070
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.