PstS1, Recombinant, Mycobacterium Tuberculosis, aa24-373, His-Tag (Phosphate-binding Protein PstS 1)

Catalog Number: USB-374919
Article Name: PstS1, Recombinant, Mycobacterium Tuberculosis, aa24-373, His-Tag (Phosphate-binding Protein PstS 1)
Biozol Catalog Number: USB-374919
Supplier Catalog Number: 374919
Alternative Catalog Number: USB-374919-20,USB-374919-100
Manufacturer: US Biological
Category: Molekularbiologie
Part of the ABC transporter complex PstSACB involved in phosphate import. Source: Recombinant protein corresponding to aa24-373 from mycobacterium tuberculosis pstS1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.8kD Amino Acid Sequence: CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.8
UniProt: P9WGU0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.