PTPN5, Recombinant, Human, aa300-555, His-SUMO-Tag (Tyrosine-protein Phosphatase Non-receptor Type 5)

Product Overview

• Article Name: PTPN5, Recombinant, Human, aa300-555, His-SUMO-Tag (Tyrosine-protein Phosphatase Non-receptor Type 5)
• Biozol Catalog Number: USB-374930
• Supplier Catalog Number: 374930
• Alternative Catalog Number: USB-374930-20,USB-374930-100,USB-374930-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors. Source: Recombinant protein corresponding to aa300-555 from human PTPN5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.5kD Amino Acid Sequence: LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 45.5
• UniProt: P54829
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.