RAB18, Recombinant, Human, aa1-206, GST-Tag (Ras-related Protein Rab-18)

Catalog Number: USB-374966
Article Name: RAB18, Recombinant, Human, aa1-206, GST-Tag (Ras-related Protein Rab-18)
Biozol Catalog Number: USB-374966
Supplier Catalog Number: 374966
Alternative Catalog Number: USB-374966-20,USB-374966-100,USB-374966-1
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration. Source: Recombinant protein corresponding to aa1-206 from human RAB18, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.7kD Amino Acid Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49.7
UniProt: Q9NP72
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.