RAB5B, Recombinant, Human, aa1-215, GST-Tag (Ras-related Protein Rab-5B)

Product Overview

• Article Name: RAB5B, Recombinant, Human, aa1-215, GST-Tag (Ras-related Protein Rab-5B)
• Biozol Catalog Number: USB-374974
• Supplier Catalog Number: 374974
• Alternative Catalog Number: USB-374974-20,USB-374974-100,USB-374974-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Protein transport. Probably involved in vesicular traffic. Source: Recombinant protein corresponding to aa1-215 from human RAB5B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.6kD Amino Acid Sequence: TSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 50.6
• UniProt: P61020
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.