RAP2B, Recombinant, Human, GST-Tag (Ras-related Protein Rap-2b)

Product Overview

• Article Name: RAP2B, Recombinant, Human, GST-Tag (Ras-related Protein Rap-2b)
• Biozol Catalog Number: USB-374992
• Supplier Catalog Number: 374992
• Alternative Catalog Number: USB-374992-20,USB-374992-100,USB-374992-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells. Source: Recombinant protein corresponding to aa1-183 from human RAP2B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.2kD Amino Acid Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 47.2
• UniProt: P61225
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.